Plant Transcription Factor Database
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_9426_iso_5
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family TALE
Protein Properties Length: 336aa    MW: 37469.7 Da    PI: 5.2718
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
                                          SS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
                             Homeobox  23 rypsaeereeLAkklgLterqVkvWFqNrRake 55 
                                          +yp+++e+ +L++ +gL++rq+ +WF N+R ++
  cra_locus_9426_iso_5_len_1549_ver_3 262 PYPTEDEKNKLSEITGLDQRQINNWFINQRKRH 294
                                          8*****************************885 PP

                                  ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
  cra_locus_9426_iso_5_len_1549_ver_3 214 ELKEMLMRKYSGYLSSLRKEFL 235
                                          9********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011883.1E-7214235IPR005539ELK domain
PROSITE profilePS5121311.383214234IPR005539ELK domain
PfamPF037892.2E-10214235IPR005539ELK domain
PROSITE profilePS5007112.438234297IPR001356Homeobox domain
SMARTSM003897.3E-13236301IPR001356Homeobox domain
CDDcd000862.33E-12250298No hitNo description
PfamPF059207.1E-16254293IPR008422Homeobox KN domain
PROSITE patternPS000270272295IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 336 aa     Download sequence    Send to blast
Nucleic Localization Signal ? help Back to Top
No. Start End Sequence
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00670PBMTransfer from GRMZM2G087741Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016499152.11e-137PREDICTED: homeobox protein knotted-1-like 1
RefseqXP_016499153.11e-137PREDICTED: homeobox protein knotted-1-like 1
SwissprotQ9FP291e-100KNOS1_ORYSJ; Homeobox protein knotted-1-like 1
TrEMBLA0A068VEZ61e-155A0A068VEZ6_COFCA; Uncharacterized protein
STRINGVIT_14s0060g01180.t011e-131(Vitis vinifera)